Lineage for d2omua1 (2omu A:418-497)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765887Family b.1.18.15: Internalin Ig-like domain [81295] (3 proteins)
    truncated fold fused to an LRR domain
  6. 2765888Protein Internalin A [81973] (1 species)
  7. 2765889Species Listeria monocytogenes [TaxId:1639] [81974] (10 PDB entries)
  8. 2765897Domain d2omua1: 2omu A:418-497 [148882]
    Other proteins in same PDB: d2omua3, d2omub2, d2omub3
    automated match to d2omza1
    complexed with ca, cl

Details for d2omua1

PDB Entry: 2omu (more details), 1.8 Å

PDB Description: crystal structure of inla g194s+s y369s/hec1 complex
PDB Compounds: (A:) Internalin-A

SCOPe Domain Sequences for d2omua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2omua1 b.1.18.15 (A:418-497) Internalin A {Listeria monocytogenes [TaxId: 1639]}
wtnapvnykanvsipntvknvtgaliapatisdggsytepditwnlpsytnevsytfsqp
vtigkgtttfsgtvtqplka

SCOPe Domain Coordinates for d2omua1:

Click to download the PDB-style file with coordinates for d2omua1.
(The format of our PDB-style files is described here.)

Timeline for d2omua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2omua3