Lineage for d2okfb_ (2okf B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2136225Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2136226Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families) (S)
  5. 2136647Family c.52.1.32: XisH-like [159601] (1 protein)
    Pfam PF08814
  6. 2136648Protein FdxN element excision controlling factor protein [159602] (2 species)
  7. 2136649Species Anabaena variabilis [TaxId:1172] [159604] (1 PDB entry)
    Uniprot Q3M7W6 4-139
  8. 2136651Domain d2okfb_: 2okf B: [148804]
    automated match to d2okfa1
    complexed with act, cl, edo

Details for d2okfb_

PDB Entry: 2okf (more details), 1.6 Å

PDB Description: crystal structure of a fdxn element excision controlling factor protein (ava_3312) from anabaena variabilis at 1.60 a resolution
PDB Compounds: (B:) FdxN element excision controlling factor protein

SCOPe Domain Sequences for d2okfb_:

Sequence, based on SEQRES records: (download)

>d2okfb_ c.52.1.32 (B:) FdxN element excision controlling factor protein {Anabaena variabilis [TaxId: 1172]}
rdvfhevvktalkkdgwqitddpltisvggvnlsidlaaqkliaaerqgqkiavevksfl
kqssaisefhtalgqfinyrgalrkvepdrvlylavplttyktffqldfpkeiiienqvk
mlvydveqevifqwin

Sequence, based on observed residues (ATOM records): (download)

>d2okfb_ c.52.1.32 (B:) FdxN element excision controlling factor protein {Anabaena variabilis [TaxId: 1172]}
rdvfhevvktalkkdgwqitddpltisvggvnlkliaaerqgqkiavevksflkqssais
efhtalgqfinyrgalrkvepdrvlylavplttyktffqldfpkeiiienqvkmlvydve
qevifqwin

SCOPe Domain Coordinates for d2okfb_:

Click to download the PDB-style file with coordinates for d2okfb_.
(The format of our PDB-style files is described here.)

Timeline for d2okfb_: