SCOP 1.75: Domain d2okfb1: 2okf B:4-139

Lineage for d2okfb1 (2okf B:4-139)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (33 families)

5. Family c.52.1.32: XisH-like [159601] (1 protein)
   Pfam PF08814

6. Protein FdxN element excision controlling factor protein [159602] (2 species)

7. Species Anabaena variabilis [TaxId:1172] [159604] (1 PDB entry)
   Uniprot Q3M7W6 4-139

8. Domain d2okfb1: 2okf B:4-139 [148804]
   automatically matched to 2OKF A:4-139
   complexed with act, cl, edo

Details for d2okfb1

PDB Entry: 2okf, 1.6 Å

PDB Description: crystal structure of a fdxn element excision controlling factor protein (ava_3312) from anabaena variabilis at 1.60 a resolution

PDB Compounds: (B:) FdxN element excision controlling factor protein

SCOP Domain Sequences for d2okfb1:

Sequence, based on SEQRES records:

>d2okfb1 c.52.1.32 (B:4-139) FdxN element excision controlling factor protein {Anabaena variabilis [TaxId: 1172]}
rdvfhevvktalkkdgwqitddpltisvggvnlsidlaaqkliaaerqgqkiavevksfl
kqssaisefhtalgqfinyrgalrkvepdrvlylavplttyktffqldfpkeiiienqvk
mlvydveqevifqwin

Sequence, based on observed residues (ATOM records):

>d2okfb1 c.52.1.32 (B:4-139) FdxN element excision controlling factor protein {Anabaena variabilis [TaxId: 1172]}
rdvfhevvktalkkdgwqitddpltisvggvnlkliaaerqgqkiavevksflkqssais
efhtalgqfinyrgalrkvepdrvlylavplttyktffqldfpkeiiienqvkmlvydve
qevifqwin

Timeline for d2okfb1:

• d2okfb1 is new in SCOP 1.75
  
• d2okfb1 is called d2okfb_ in SCOPe 2.01
  
• d2okfb1 appears in the current release, SCOPe 2.08, called d2okfb_