![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
![]() | Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) ![]() |
![]() | Family c.52.1.32: XisH-like [159601] (1 protein) Pfam PF08814 |
![]() | Protein FdxN element excision controlling factor protein [159602] (2 species) |
![]() | Species Anabaena variabilis [TaxId:1172] [159604] (1 PDB entry) Uniprot Q3M7W6 4-139 |
![]() | Domain d2okfb_: 2okf B: [148804] automated match to d2okfa1 complexed with act, cl, edo |
PDB Entry: 2okf (more details), 1.6 Å
SCOPe Domain Sequences for d2okfb_:
Sequence, based on SEQRES records: (download)
>d2okfb_ c.52.1.32 (B:) FdxN element excision controlling factor protein {Anabaena variabilis [TaxId: 1172]} rdvfhevvktalkkdgwqitddpltisvggvnlsidlaaqkliaaerqgqkiavevksfl kqssaisefhtalgqfinyrgalrkvepdrvlylavplttyktffqldfpkeiiienqvk mlvydveqevifqwin
>d2okfb_ c.52.1.32 (B:) FdxN element excision controlling factor protein {Anabaena variabilis [TaxId: 1172]} rdvfhevvktalkkdgwqitddpltisvggvnlkliaaerqgqkiavevksflkqssais efhtalgqfinyrgalrkvepdrvlylavplttyktffqldfpkeiiienqvkmlvydve qevifqwin
Timeline for d2okfb_: