Class b: All beta proteins [48724] (180 folds) |
Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin-like [50891] (5 families) |
Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins) automatically mapped to Pfam PF00160 |
Protein Cyclophilin-like protein PPIL3B [141509] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141510] (3 PDB entries) Uniprot Q9H2H8 1-160 |
Domain d2ojua2: 2oju A:7-165 [148798] Other proteins in same PDB: d2ojua3, d2ojub3 automated match to d1xyha1 |
PDB Entry: 2oju (more details), 2.4 Å
SCOPe Domain Sequences for d2ojua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ojua2 b.62.1.1 (A:7-165) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} msvtlhtdvgdikievfcertpktcenflalcasnyyngcifhrnikgfmvqtgdptgtg rggnsiwgkkfedeyseylkhnvrgvvsmanngpntngsqffitygkqphldmkytvfgk vidgletldeleklpvnektyrplndvhikditihanpf
Timeline for d2ojua2: