SCOPe 2.08: Domain d2ojub2: 2oju B:7-166

Lineage for d2ojub2 (2oju B:7-166)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein Cyclophilin-like protein PPIL3B [141509] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141510] (3 PDB entries)
   Uniprot Q9H2H8 1-160

8. Domain d2ojub2: 2oju B:7-166 [148799]
   Other proteins in same PDB: d2ojua3, d2ojub3
   automated match to d1xyha1

Details for d2ojub2

PDB Entry: 2oju, 2.4 Å

PDB Description: X-ray structure of complex of human cyclophilin J with cyclosporin A

PDB Compounds: (B:) Peptidyl-prolyl cis-trans isomerase-like 3

SCOPe Domain Sequences for d2ojub2:

Sequence; same for both SEQRES and ATOM records:

>d2ojub2 b.62.1.1 (B:7-166) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]}
msvtlhtdvgdikievfcertpktcenflalcasnyyngcifhrnikgfmvqtgdptgtg
rggnsiwgkkfedeyseylkhnvrgvvsmanngpntngsqffitygkqphldmkytvfgk
vidgletldeleklpvnektyrplndvhikditihanpfa

Timeline for d2ojub2:

• d2ojub2 first appeared in SCOP 1.75, called d2ojub1
  
• d2ojub2 appears in SCOPe 2.07