Lineage for d2ojub2 (2oju B:7-166)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2806645Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2806646Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2806647Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2806901Protein Cyclophilin-like protein PPIL3B [141509] (1 species)
  7. 2806902Species Human (Homo sapiens) [TaxId:9606] [141510] (3 PDB entries)
    Uniprot Q9H2H8 1-160
  8. 2806905Domain d2ojub2: 2oju B:7-166 [148799]
    Other proteins in same PDB: d2ojua3, d2ojub3
    automated match to d1xyha1

Details for d2ojub2

PDB Entry: 2oju (more details), 2.4 Å

PDB Description: X-ray structure of complex of human cyclophilin J with cyclosporin A
PDB Compounds: (B:) Peptidyl-prolyl cis-trans isomerase-like 3

SCOPe Domain Sequences for d2ojub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ojub2 b.62.1.1 (B:7-166) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]}
msvtlhtdvgdikievfcertpktcenflalcasnyyngcifhrnikgfmvqtgdptgtg
rggnsiwgkkfedeyseylkhnvrgvvsmanngpntngsqffitygkqphldmkytvfgk
vidgletldeleklpvnektyrplndvhikditihanpfa

SCOPe Domain Coordinates for d2ojub2:

Click to download the PDB-style file with coordinates for d2ojub2.
(The format of our PDB-style files is described here.)

Timeline for d2ojub2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ojub3