| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.281: YheA-like [158621] (1 superfamily) 5 helices; "kinked" antiparallel coiled coil; forms flexible oligomeric assemblies via two different dimerisation interfaces |
Superfamily a.281.1: YheA/YmcA-like [158622] (2 families) ![]() |
| Family a.281.1.2: YheA-like [158626] (4 proteins) Pfam PF06133; DUF964 |
| Protein automated matches [190757] (1 species) not a true protein |
| Species Geobacillus stearothermophilus [TaxId:1422] [187955] (1 PDB entry) |
| Domain d2oeqb_: 2oeq B: [148755] Other proteins in same PDB: d2oeqa1 automated match to d2oeqa1 |
PDB Entry: 2oeq (more details), 2.9 Å
SCOPe Domain Sequences for d2oeqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oeqb_ a.281.1.2 (B:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
eplhalarqleqairasepfqqlkrayedvrrdetayrmfanvrdiqlrlhekqmrgaai
lpdeieqaqkamalaqqneklarlmaleqqmsitiaevqqiamkpleelhrsfm
Timeline for d2oeqb_: