Lineage for d2oeqd_ (2oeq D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2739109Fold a.281: YheA-like [158621] (1 superfamily)
    5 helices; "kinked" antiparallel coiled coil; forms flexible oligomeric assemblies via two different dimerisation interfaces
  4. 2739110Superfamily a.281.1: YheA/YmcA-like [158622] (2 families) (S)
  5. 2739118Family a.281.1.2: YheA-like [158626] (4 proteins)
    Pfam PF06133; DUF964
  6. 2739132Protein automated matches [190757] (1 species)
    not a true protein
  7. 2739133Species Geobacillus stearothermophilus [TaxId:1422] [187955] (1 PDB entry)
  8. 2739136Domain d2oeqd_: 2oeq D: [148757]
    Other proteins in same PDB: d2oeqa1
    automated match to d2oeqa1

Details for d2oeqd_

PDB Entry: 2oeq (more details), 2.9 Å

PDB Description: protein of unknown function (duf964) from bacillus stearothermophilus
PDB Compounds: (D:) Protein of unknown function, DUF964

SCOPe Domain Sequences for d2oeqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oeqd_ a.281.1.2 (D:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
mseplhalarqleqairasepfqqlkrayedvrrdetayrmfanvrdiqlrlhekqmrga
ailpdeieqaqkamalaqqneklarlmaleqqmsitiaevqqiamkpleelhrsfm

SCOPe Domain Coordinates for d2oeqd_:

Click to download the PDB-style file with coordinates for d2oeqd_.
(The format of our PDB-style files is described here.)

Timeline for d2oeqd_: