Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) duplication contains two domains of this fold |
Family c.55.1.1: Actin/HSP70 [53068] (7 proteins) |
Protein Actin [53073] (6 species) |
Species Cow (Bos taurus) [TaxId:9913] [53074] (26 PDB entries) |
Domain d2oand1: 2oan D:6-146 [148712] automatically matched to d1hlua1 complexed with atp, ca, so4 |
PDB Entry: 2oan (more details), 2.61 Å
SCOPe Domain Sequences for d2oand1:
Sequence, based on SEQRES records: (download)
>d2oand1 c.55.1.1 (D:6-146) Actin {Cow (Bos taurus) [TaxId: 9913]} aalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgil tlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfe tfntpamyvaiqavlslyasg
>d2oand1 c.55.1.1 (D:6-146) Actin {Cow (Bos taurus) [TaxId: 9913]} aalvvdngsgmckagfagddapravfpsivgrprkdsyvgdeaqskrgiltlkypiehgi vtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetfntpamyva iqavlslyasg
Timeline for d2oand1: