Lineage for d2oanb2 (2oan B:147-371)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 995076Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 995077Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 995078Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 995079Protein Actin [53073] (6 species)
  7. 995090Species Cow (Bos taurus) [TaxId:9913] [53074] (26 PDB entries)
  8. 995144Domain d2oanb2: 2oan B:147-371 [148709]
    automatically matched to d1hlua2
    complexed with atp, ca, so4

Details for d2oanb2

PDB Entry: 2oan (more details), 2.61 Å

PDB Description: structure of oxidized beta-actin
PDB Compounds: (B:) Actin, cytoplasmic 1

SCOPe Domain Sequences for d2oanb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oanb2 c.55.1.1 (B:147-371) Actin {Cow (Bos taurus) [TaxId: 9913]}
rttgivmdsgdgvthtvpiyegyalphailrldlagrdltdylmkiltergysftttaer
eivrdikeklcyvaldfeqemataassssleksyelpdgqvitignerfrcpealfqpsf
lgmescgihettfnsimkcdvdirkdlyantvlsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwiskqeydesgpsivh

SCOPe Domain Coordinates for d2oanb2:

Click to download the PDB-style file with coordinates for d2oanb2.
(The format of our PDB-style files is described here.)

Timeline for d2oanb2: