| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.1: Actin/HSP70 [53068] (7 proteins) |
| Protein Actin [53073] (6 species) |
| Species Cow (Bos taurus) [TaxId:9913] [53074] (26 PDB entries) |
| Domain d2oanb2: 2oan B:147-371 [148709] automatically matched to d1hlua2 complexed with atp, ca, so4 |
PDB Entry: 2oan (more details), 2.61 Å
SCOPe Domain Sequences for d2oanb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oanb2 c.55.1.1 (B:147-371) Actin {Cow (Bos taurus) [TaxId: 9913]}
rttgivmdsgdgvthtvpiyegyalphailrldlagrdltdylmkiltergysftttaer
eivrdikeklcyvaldfeqemataassssleksyelpdgqvitignerfrcpealfqpsf
lgmescgihettfnsimkcdvdirkdlyantvlsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwiskqeydesgpsivh
Timeline for d2oanb2: