Lineage for d2oanc1 (2oan C:6-146)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 995076Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 995077Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 995078Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 995079Protein Actin [53073] (6 species)
  7. 995090Species Cow (Bos taurus) [TaxId:9913] [53074] (26 PDB entries)
  8. 995145Domain d2oanc1: 2oan C:6-146 [148710]
    automatically matched to d1hlua1
    complexed with atp, ca, so4

Details for d2oanc1

PDB Entry: 2oan (more details), 2.61 Å

PDB Description: structure of oxidized beta-actin
PDB Compounds: (C:) Actin, cytoplasmic 1

SCOPe Domain Sequences for d2oanc1:

Sequence, based on SEQRES records: (download)

>d2oanc1 c.55.1.1 (C:6-146) Actin {Cow (Bos taurus) [TaxId: 9913]}
aalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgil
tlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfe
tfntpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records): (download)

>d2oanc1 c.55.1.1 (C:6-146) Actin {Cow (Bos taurus) [TaxId: 9913]}
aalvvdngsgmckagfagddapravfpsivgrprkdsyvgdeaqskrgiltlkypiehgi
vtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetfntpamyva
iqavlslyasg

SCOPe Domain Coordinates for d2oanc1:

Click to download the PDB-style file with coordinates for d2oanc1.
(The format of our PDB-style files is described here.)

Timeline for d2oanc1: