Class a: All alpha proteins [46456] (290 folds) |
Fold a.288: UraD-like [158693] (1 superfamily) multihelical; irregular array of long and short helices |
Superfamily a.288.1: UraD-Like [158694] (1 family) automatically mapped to Pfam PF09349 |
Family a.288.1.1: UraD-like [158695] (2 proteins) Pfam PF09349; OHCU decarboxylase (formerly DUF1991) |
Protein OHCU decarboxylase, UraD [158696] (2 species) 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase |
Species Zebrafish (Danio rerio) [TaxId:7955] [158698] (3 PDB entries) Uniprot A1L259 2-166 |
Domain d2o70e_: 2o70 E: [148649] automated match to d2o70a1 |
PDB Entry: 2o70 (more details), 1.8 Å
SCOPe Domain Sequences for d2o70e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o70e_ a.288.1.1 (E:) OHCU decarboxylase, UraD {Zebrafish (Danio rerio) [TaxId: 7955]} dinvvnalayedfvklfgnvvekcplisaaiwsyrpfkdladiearisefihslpdsgke gilrchpdlagrdlqsgtltpesqeeqsqagmttldsaeivhmyrlnseykerfgfpfvi carlnnkadivrqlserlknrrtaelecaieevkkicslrlhsi
Timeline for d2o70e_: