Lineage for d2o70b_ (2o70 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2739220Fold a.288: UraD-like [158693] (1 superfamily)
    multihelical; irregular array of long and short helices
  4. 2739221Superfamily a.288.1: UraD-Like [158694] (1 family) (S)
    automatically mapped to Pfam PF09349
  5. 2739222Family a.288.1.1: UraD-like [158695] (2 proteins)
    Pfam PF09349; OHCU decarboxylase (formerly DUF1991)
  6. 2739226Protein OHCU decarboxylase, UraD [158696] (2 species)
    2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase
  7. 2739229Species Zebrafish (Danio rerio) [TaxId:7955] [158698] (3 PDB entries)
    Uniprot A1L259 2-166
  8. 2739231Domain d2o70b_: 2o70 B: [148646]
    automated match to d2o70a1

Details for d2o70b_

PDB Entry: 2o70 (more details), 1.8 Å

PDB Description: Structure of OHCU decarboxylase from zebrafish
PDB Compounds: (B:) OHCU decarboxylase

SCOPe Domain Sequences for d2o70b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o70b_ a.288.1.1 (B:) OHCU decarboxylase, UraD {Zebrafish (Danio rerio) [TaxId: 7955]}
dinvvnalayedfvklfgnvvekcplisaaiwsyrpfkdladiearisefihslpdsgke
gilrchpdlagrdlqsgtltpesqeeqsqagmttldsaeivhmyrlnseykerfgfpfvi
carlnnkadivrqlserlknrrtaelecaieevkkicslrlhsi

SCOPe Domain Coordinates for d2o70b_:

Click to download the PDB-style file with coordinates for d2o70b_.
(The format of our PDB-style files is described here.)

Timeline for d2o70b_: