SCOP 1.75: Domain d2o70e1: 2o70 E:2-165

Lineage for d2o70e1 (2o70 E:2-165)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.288: UraD-like [158693] (1 superfamily)
   multihelical; irregular array of long and short helices

4. Superfamily a.288.1: UraD-Like [158694] (1 family)

5. Family a.288.1.1: UraD-like [158695] (2 proteins)
   Pfam PF09349; OHCU decarboxylase (formerly DUF1991)

6. Protein OHCU decarboxylase, UraD [158696] (2 species)
   2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase

7. Species Zebrafish (Brachydanio rerio) [TaxId:7955] [158698] (3 PDB entries)
   Uniprot A1L259 2-166

8. Domain d2o70e1: 2o70 E:2-165 [148649]
   automatically matched to 2O70 A:2-166

Details for d2o70e1

PDB Entry: 2o70, 1.8 Å

PDB Description: Structure of OHCU decarboxylase from zebrafish

PDB Compounds: (E:) OHCU decarboxylase

SCOP Domain Sequences for d2o70e1:

Sequence; same for both SEQRES and ATOM records:

>d2o70e1 a.288.1.1 (E:2-165) OHCU decarboxylase, UraD {Zebrafish (Brachydanio rerio) [TaxId: 7955]}
dinvvnalayedfvklfgnvvekcplisaaiwsyrpfkdladiearisefihslpdsgke
gilrchpdlagrdlqsgtltpesqeeqsqagmttldsaeivhmyrlnseykerfgfpfvi
carlnnkadivrqlserlknrrtaelecaieevkkicslrlhsi

Timeline for d2o70e1:

• d2o70e1 is new in SCOP 1.75
  
• d2o70e1 is called d2o70e_ in SCOPe 2.01
  
• d2o70e1 appears in the current release, SCOPe 2.08, called d2o70e_