Lineage for d2o4ga1 (2o4g A:9-234)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2123751Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2124334Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 protein domains)
    contains Pfam PF00929
  6. 2124695Protein Three prime repair exonuclease 1, TREX1 [159631] (1 species)
  7. 2124696Species Mouse (Mus musculus) [TaxId:10090] [159632] (6 PDB entries)
    Uniprot Q91XB0 5-234! Uniprot Q91XB0 9-234
  8. 2124702Domain d2o4ga1: 2o4g A:9-234 [148584]
    Other proteins in same PDB: d2o4gb_, d2o4gc_, d2o4gd_
    protein/DNA complex; complexed with mg, tmp

Details for d2o4ga1

PDB Entry: 2o4g (more details), 2.35 Å

PDB Description: Structure of TREX1 in complex with a nucleotide
PDB Compounds: (A:) Three prime repair exonuclease 1

SCOPe Domain Sequences for d2o4ga1:

Sequence, based on SEQRES records: (download)

>d2o4ga1 c.55.3.5 (A:9-234) Three prime repair exonuclease 1, TREX1 {Mouse (Mus musculus) [TaxId: 10090]}
ghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprvvdkls
lciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahngdr
ydfpllqtelarlstpspldgtfcvdsiaalkaleqasspsgngsrksyslgsiytrlyw
qaptdshtaegdvltllsicqwkpqallqwvdeharpfstvkpmyg

Sequence, based on observed residues (ATOM records): (download)

>d2o4ga1 c.55.3.5 (A:9-234) Three prime repair exonuclease 1, TREX1 {Mouse (Mus musculus) [TaxId: 10090]}
ghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprvvdkls
lciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahngdr
ydfpllqtelarlstpspldgtfcvdsiaalkaleqaksyslgsiytrlywqaptdshta
egdvltllsicqwkpqallqwvdeharpfstvkpmyg

SCOPe Domain Coordinates for d2o4ga1:

Click to download the PDB-style file with coordinates for d2o4ga1.
(The format of our PDB-style files is described here.)

Timeline for d2o4ga1: