![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
![]() | Protein automated matches [190396] (40 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [187264] (6 PDB entries) |
![]() | Domain d2o4gc_: 2o4g C: [148586] Other proteins in same PDB: d2o4ga1 automated match to d1y97a1 protein/DNA complex; complexed with mg, tmp |
PDB Entry: 2o4g (more details), 2.35 Å
SCOPe Domain Sequences for d2o4gc_:
Sequence, based on SEQRES records: (download)
>d2o4gc_ c.55.3.0 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprvvdkls lciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahngdr ydfpllqtelarlstpspldgtfcvdsiaalkaleqasspsgngsrksyslgsiytrlyw qaptdshtaegdvltllsicqwkpqallqwvdeharpfstvkpmyg
>d2o4gc_ c.55.3.0 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprvvdkls lciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahngdr ydfpllqtelarlstpspldgtfcvdsiaalkaleqaksyslgsiytrlywqaptdshta egdvltllsicqwkpqallqwvdeharpfstvkpmyg
Timeline for d2o4gc_: