PDB entry 2o4g

View 2o4g on RCSB PDB site
Description: Structure of TREX1 in complex with a nucleotide
Class: hydrolase
Keywords: TREX1, exonuclease, DnaQ, DNA complex, WW motif, protein-protein interaction, polyproline binding motif, HYDROLASE
Deposited on 2006-12-04, released 2007-03-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.206
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Three prime repair exonuclease 1
    Species: Mus musculus [TaxId:10090]
    Gene: Trex1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2o4ga1
  • Chain 'B':
    Compound: Three prime repair exonuclease 1
    Species: Mus musculus [TaxId:10090]
    Gene: Trex1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2o4gb_
  • Chain 'C':
    Compound: Three prime repair exonuclease 1
    Species: Mus musculus [TaxId:10090]
    Gene: Trex1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2o4gc_
  • Chain 'D':
    Compound: Three prime repair exonuclease 1
    Species: Mus musculus [TaxId:10090]
    Gene: Trex1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2o4gd_
  • Heterogens: MG, TMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o4gA (A:)
    mkhhhhhhpmghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvp
    rpprvvdklslciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqp
    cclvahngdrydfpllqtelarlstpspldgtfcvdsiaalkaleqasspsgngsrksys
    lgsiytrlywqaptdshtaegdvltllsicqwkpqallqwvdeharpfstvkpmygtpat
    tgttnlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o4gA (A:)
    ghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprvvdkls
    lciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahngdr
    ydfpllqtelarlstpspldgtfcvdsiaalkaleqaksyslgsiytrlywqaptdshta
    egdvltllsicqwkpqallqwvdeharpfstvkpmyg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2o4gB (B:)
    mkhhhhhhpmghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvp
    rpprvvdklslciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqp
    cclvahngdrydfpllqtelarlstpspldgtfcvdsiaalkaleqasspsgngsrksys
    lgsiytrlywqaptdshtaegdvltllsicqwkpqallqwvdeharpfstvkpmygtpat
    tgttnlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o4gB (B:)
    ghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprvvdkls
    lciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahngdr
    ydfpllqtelarlstpspldgtfcvdsiaalkaleqaksyslgsiytrlywqaptdshta
    egdvltllsicqwkpqallqwvdeharpfstvkpmyg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2o4gC (C:)
    mkhhhhhhpmghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvp
    rpprvvdklslciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqp
    cclvahngdrydfpllqtelarlstpspldgtfcvdsiaalkaleqasspsgngsrksys
    lgsiytrlywqaptdshtaegdvltllsicqwkpqallqwvdeharpfstvkpmygtpat
    tgttnlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o4gC (C:)
    ghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprvvdkls
    lciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahngdr
    ydfpllqtelarlstpspldgtfcvdsiaalkaleqaksyslgsiytrlywqaptdshta
    egdvltllsicqwkpqallqwvdeharpfstvkpmyg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2o4gD (D:)
    mkhhhhhhpmghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvp
    rpprvvdklslciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqp
    cclvahngdrydfpllqtelarlstpspldgtfcvdsiaalkaleqasspsgngsrksys
    lgsiytrlywqaptdshtaegdvltllsicqwkpqallqwvdeharpfstvkpmygtpat
    tgttnlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o4gD (D:)
    ghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprvvdkls
    lciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahngdr
    ydfpllqtelarlstpspldgtfcvdsiaalkaleqaksyslgsiytrlywqaptdshta
    egdvltllsicqwkpqallqwvdeharpfstvkpmyg