SCOPe 2.08: Domain d2o4gb_: 2o4g B:

Lineage for d2o4gb_ (2o4g B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187264] (6 PDB entries)

8. Domain d2o4gb_: 2o4g B: [148585]
   Other proteins in same PDB: d2o4ga1
   automated match to d1y97a1
   protein/DNA complex; complexed with mg, tmp

Details for d2o4gb_

PDB Entry: 2o4g, 2.35 Å

PDB Description: Structure of TREX1 in complex with a nucleotide

PDB Compounds: (B:) Three prime repair exonuclease 1

SCOPe Domain Sequences for d2o4gb_:

Sequence, based on SEQRES records:

>d2o4gb_ c.55.3.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprvvdkls
lciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahngdr
ydfpllqtelarlstpspldgtfcvdsiaalkaleqasspsgngsrksyslgsiytrlyw
qaptdshtaegdvltllsicqwkpqallqwvdeharpfstvkpmyg

Sequence, based on observed residues (ATOM records):

>d2o4gb_ c.55.3.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprvvdkls
lciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahngdr
ydfpllqtelarlstpspldgtfcvdsiaalkaleqaksyslgsiytrlywqaptdshta
egdvltllsicqwkpqallqwvdeharpfstvkpmyg

Timeline for d2o4gb_:

• d2o4gb_ first appeared in SCOP 1.75, called d2o4gb1
  
• d2o4gb_ appears in SCOPe 2.07