SCOPe 2.08: Domain d2nzxc_: 2nzx C:

Lineage for d2nzxc_ (2nzx C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
   consists of two non-similar domains with 3 layers (a/b/a) each
   domain 1: parallel beta-sheet of 7 strands, order 3214567
   domain 2: parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families)

5. Family c.87.1.11: FucT-like [159794] (2 proteins)
   Pfam PF00852; Glycosyltransferase family 10 (fucosyltransferase)

6. Protein Alpha1,3-fucosyltransferase FucT [159795] (1 species)

7. Species Helicobacter pylori [TaxId:210] [159796] (3 PDB entries)
   Uniprot O30511 1-349

8. Domain d2nzxc_: 2nzx C: [148537]
   automated match to d2nzwa1
   complexed with gdp, so4

Details for d2nzxc_

PDB Entry: 2nzx, 1.9 Å

PDB Description: crystal structure of alpha1,3-fucosyltransferase with gdp

PDB Compounds: (C:) Alpha1,3-fucosyltransferase

SCOPe Domain Sequences for d2nzxc_:

Sequence; same for both SEQRES and ATOM records:

>d2nzxc_ c.87.1.11 (C:) Alpha1,3-fucosyltransferase FucT {Helicobacter pylori [TaxId: 210]}
mfqplldayvesasiekmasksppplkiavanwwgdeeikefknsvlyfilsqrytitlh
qnpnefsdlvfgnplgsarkilsyqnakrvfytgenespnfnlfdyaigfdeldfndryl
rmplyydrlhhkaesvndttapyklkdnslyalkkpshcfkekhpnlcavvndesdplkr
gfasfvasnpnapirnafydalnsiepvtgggsvrntlgynvknkneflsqykfnlcfen
tqgygyvtekiidayfshtipiywgspsvakdfnpksfvnvhdfknfdeaidyikylhth
knayldmlyenplntldgkayfyqnlsfkkilaffktilendtiyhdnpf

Timeline for d2nzxc_:

• d2nzxc_ first appeared in SCOP 1.75, called d2nzxc1
  
• d2nzxc_ appears in SCOPe 2.07