![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily) consists of two non-similar domains with 3 layers (a/b/a) each domain 1: parallel beta-sheet of 7 strands, order 3214567 domain 2: parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (11 families) ![]() |
![]() | Family c.87.1.11: FucT-like [159794] (1 protein) Pfam PF00852; Glycosyltransferase family 10 (fucosyltransferase) |
![]() | Protein Alpha1,3-fucosyltransferase FucT [159795] (1 species) |
![]() | Species Helicobacter pylori [TaxId:210] [159796] (3 PDB entries) Uniprot O30511 1-349 |
![]() | Domain d2nzxc1: 2nzx C:1-349 [148537] automatically matched to 2NZW A:1-349 complexed with gdp, so4 |
PDB Entry: 2nzx (more details), 1.9 Å
SCOP Domain Sequences for d2nzxc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nzxc1 c.87.1.11 (C:1-349) Alpha1,3-fucosyltransferase FucT {Helicobacter pylori [TaxId: 210]} mfqplldayvesasiekmasksppplkiavanwwgdeeikefknsvlyfilsqrytitlh qnpnefsdlvfgnplgsarkilsyqnakrvfytgenespnfnlfdyaigfdeldfndryl rmplyydrlhhkaesvndttapyklkdnslyalkkpshcfkekhpnlcavvndesdplkr gfasfvasnpnapirnafydalnsiepvtgggsvrntlgynvknkneflsqykfnlcfen tqgygyvtekiidayfshtipiywgspsvakdfnpksfvnvhdfknfdeaidyikylhth knayldmlyenplntldgkayfyqnlsfkkilaffktilendtiyhdnp
Timeline for d2nzxc1: