Lineage for d2nzxa_ (2nzx A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142507Family c.87.1.11: FucT-like [159794] (1 protein)
    Pfam PF00852; Glycosyltransferase family 10 (fucosyltransferase)
  6. 2142508Protein Alpha1,3-fucosyltransferase FucT [159795] (1 species)
  7. 2142509Species Helicobacter pylori [TaxId:210] [159796] (3 PDB entries)
    Uniprot O30511 1-349
  8. 2142510Domain d2nzxa_: 2nzx A: [148535]
    automated match to d2nzwa1
    complexed with gdp, so4

Details for d2nzxa_

PDB Entry: 2nzx (more details), 1.9 Å

PDB Description: crystal structure of alpha1,3-fucosyltransferase with gdp
PDB Compounds: (A:) Alpha1,3-fucosyltransferase

SCOPe Domain Sequences for d2nzxa_:

Sequence, based on SEQRES records: (download)

>d2nzxa_ c.87.1.11 (A:) Alpha1,3-fucosyltransferase FucT {Helicobacter pylori [TaxId: 210]}
mfqplldayvesasiekmasksppplkiavanwwgdeeikefknsvlyfilsqrytitlh
qnpnefsdlvfgnplgsarkilsyqnakrvfytgenespnfnlfdyaigfdeldfndryl
rmplyydrlhhkaesvndttapyklkdnslyalkkpshcfkekhpnlcavvndesdplkr
gfasfvasnpnapirnafydalnsiepvtgggsvrntlgynvknkneflsqykfnlcfen
tqgygyvtekiidayfshtipiywgspsvakdfnpksfvnvhdfknfdeaidyikylhth
knayldmlyenplntldgkayfyqnlsfkkilaffktilendtiyhdnp

Sequence, based on observed residues (ATOM records): (download)

>d2nzxa_ c.87.1.11 (A:) Alpha1,3-fucosyltransferase FucT {Helicobacter pylori [TaxId: 210]}
mfqplldayvesasiekmasksppplkiavanwwgdeeikefknsvlyfilsqrytitlh
qnpnefsdlvfgnpyqnakrvfytgenespnfnlfdyaigfdeldfndrylrmplyydrl
hhkaesvndttapyklkdnslyalkkpshcfkekhpnlcavvndesdplkrgfasfvasn
pnapirnafydalnsiepvtgggsvrntlgynvknkneflsqykfnlcfentqgygyvte
kiidayfshtipiywgspsvakdfnpksfvnvhdfknfdeaidyikylhthknayldmly
enplntldgkayfyqnlsfkkilaffktilendtiyhdnp

SCOPe Domain Coordinates for d2nzxa_:

Click to download the PDB-style file with coordinates for d2nzxa_.
(The format of our PDB-style files is described here.)

Timeline for d2nzxa_: