PDB entry 2nzx

View 2nzx on RCSB PDB site
Description: Crystal Structure of alpha1,3-Fucosyltransferase with GDP
Class: transferase
Keywords: Alpha1, 3-Fucosyltransferase, Fucosyltransferase, FucT, GT 10, TRANSFERASE
Deposited on 2006-11-27, released 2007-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha1,3-fucosyltransferase
    Species: Helicobacter pylori [TaxId:210]
    Gene: AF008596
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2nzxa_
  • Chain 'B':
    Compound: Alpha1,3-fucosyltransferase
    Species: Helicobacter pylori [TaxId:210]
    Gene: AF008596
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2nzxb_
  • Chain 'C':
    Compound: Alpha1,3-fucosyltransferase
    Species: Helicobacter pylori [TaxId:210]
    Gene: AF008596
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2nzxc_
  • Heterogens: GDP, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nzxA (A:)
    mfqplldayvesasiekmasksppplkiavanwwgdeeikefknsvlyfilsqrytitlh
    qnpnefsdlvfgnplgsarkilsyqnakrvfytgenespnfnlfdyaigfdeldfndryl
    rmplyydrlhhkaesvndttapyklkdnslyalkkpshcfkekhpnlcavvndesdplkr
    gfasfvasnpnapirnafydalnsiepvtgggsvrntlgynvknkneflsqykfnlcfen
    tqgygyvtekiidayfshtipiywgspsvakdfnpksfvnvhdfknfdeaidyikylhth
    knayldmlyenplntldgkayfyqnlsfkkilaffktilendtiyhdnpfifcrdlnepl
    vtilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nzxA (A:)
    mfqplldayvesasiekmasksppplkiavanwwgdeeikefknsvlyfilsqrytitlh
    qnpnefsdlvfgnpyqnakrvfytgenespnfnlfdyaigfdeldfndrylrmplyydrl
    hhkaesvndttapyklkdnslyalkkpshcfkekhpnlcavvndesdplkrgfasfvasn
    pnapirnafydalnsiepvtgggsvrntlgynvknkneflsqykfnlcfentqgygyvte
    kiidayfshtipiywgspsvakdfnpksfvnvhdfknfdeaidyikylhthknayldmly
    enplntldgkayfyqnlsfkkilaffktilendtiyhdnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2nzxB (B:)
    mfqplldayvesasiekmasksppplkiavanwwgdeeikefknsvlyfilsqrytitlh
    qnpnefsdlvfgnplgsarkilsyqnakrvfytgenespnfnlfdyaigfdeldfndryl
    rmplyydrlhhkaesvndttapyklkdnslyalkkpshcfkekhpnlcavvndesdplkr
    gfasfvasnpnapirnafydalnsiepvtgggsvrntlgynvknkneflsqykfnlcfen
    tqgygyvtekiidayfshtipiywgspsvakdfnpksfvnvhdfknfdeaidyikylhth
    knayldmlyenplntldgkayfyqnlsfkkilaffktilendtiyhdnpfifcrdlnepl
    vtilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nzxB (B:)
    mfqplldayvesasiekmasksppplkiavanwwgdeeikefknsvlyfilsqrytitlh
    qnpnefsdlvfgnpqnakrvfytgenespnfnlfdyaigfdeldfndrylrmplyydrlh
    hkaesvndttapyklkdnslyalkkpshcfkekhpnlcavvndesdplkrgfasfvasnp
    napirnafydalnsiepvtgggsvrntlgynvknkneflsqykfnlcfentqgygyvtek
    iidayfshtipiywgspsvakdfnpksfvnvhdfknfdeaidyikylhthknayldmlye
    nplntldgkayfyqnlsfkkilaffktilendtiyhdn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2nzxC (C:)
    mfqplldayvesasiekmasksppplkiavanwwgdeeikefknsvlyfilsqrytitlh
    qnpnefsdlvfgnplgsarkilsyqnakrvfytgenespnfnlfdyaigfdeldfndryl
    rmplyydrlhhkaesvndttapyklkdnslyalkkpshcfkekhpnlcavvndesdplkr
    gfasfvasnpnapirnafydalnsiepvtgggsvrntlgynvknkneflsqykfnlcfen
    tqgygyvtekiidayfshtipiywgspsvakdfnpksfvnvhdfknfdeaidyikylhth
    knayldmlyenplntldgkayfyqnlsfkkilaffktilendtiyhdnpfifcrdlnepl
    vtilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nzxC (C:)
    mfqplldayvesasiekmasksppplkiavanwwgdeeikefknsvlyfilsqrytitlh
    qnpnefsdlvfgnplgsarkilsyqnakrvfytgenespnfnlfdyaigfdeldfndryl
    rmplyydrlhhkaesvndttapyklkdnslyalkkpshcfkekhpnlcavvndesdplkr
    gfasfvasnpnapirnafydalnsiepvtgggsvrntlgynvknkneflsqykfnlcfen
    tqgygyvtekiidayfshtipiywgspsvakdfnpksfvnvhdfknfdeaidyikylhth
    knayldmlyenplntldgkayfyqnlsfkkilaffktilendtiyhdnpf