Lineage for d2nvbd2 (2nvb D:140-313)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 975118Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 975119Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 975120Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins)
    N-terminal all-beta domain defines family
  6. 975319Protein Bacterial secondary alcohol dehydrogenase [51742] (2 species)
  7. 975333Species Thermoanaerobacter brockii [TaxId:29323] [51744] (4 PDB entries)
  8. 975345Domain d2nvbd2: 2nvb D:140-313 [148467]
    Other proteins in same PDB: d2nvba1, d2nvbb1, d2nvbc1, d2nvbd1
    automatically matched to d1bxza2
    complexed with nap, zn

Details for d2nvbd2

PDB Entry: 2nvb (more details), 2.8 Å

PDB Description: contribution of pro275 to the thermostability of the alcohol dehydrogenases (adhs)
PDB Compounds: (D:) NADP-dependent alcohol dehydrogenase

SCOPe Domain Sequences for d2nvbd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nvbd2 c.2.1.1 (D:140-313) Bacterial secondary alcohol dehydrogenase {Thermoanaerobacter brockii [TaxId: 29323]}
ipleaavmipdmmttgfhgaeladielgatvavlgigpvglmavagaklrgagriiavgs
rpvcvdaakyygatdivnykdgpiesqimnltegkgvdaaiiaggnadimatavkivkpg
gtianvnyfgegevldvprlewgcgmahktikgglcpggrlrmerlidlvfykr

SCOPe Domain Coordinates for d2nvbd2:

Click to download the PDB-style file with coordinates for d2nvbd2.
(The format of our PDB-style files is described here.)

Timeline for d2nvbd2: