| Class b: All beta proteins [48724] (174 folds) |
| Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
Superfamily b.35.1: GroES-like [50129] (3 families) ![]() |
| Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins) C-terminal domain is alpha/beta (classical Rossmann-fold) |
| Protein Bacterial secondary alcohol dehydrogenase [50142] (2 species) |
| Species Thermoanaerobacter brockii [TaxId:29323] [50144] (4 PDB entries) |
| Domain d2nvbb1: 2nvb B:1-139,B:314-352 [148462] Other proteins in same PDB: d2nvba2, d2nvbb2, d2nvbc2, d2nvbd2 automatically matched to d1bxza1 complexed with nap, zn |
PDB Entry: 2nvb (more details), 2.8 Å
SCOPe Domain Sequences for d2nvbb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nvbb1 b.35.1.2 (B:1-139,B:314-352) Bacterial secondary alcohol dehydrogenase {Thermoanaerobacter brockii [TaxId: 29323]}
mkgfamlsigkvgwiekekpapgpfdaivrplavapctsdihtvfegaigerhnmilghe
avgevvevgsevkdfkpgdrvvvpaitpdwrtsevqrgyhqhsggmlagwkfsnvkdgvf
geffhvndadmnlahlpkeXvdpsklvthvfrgfdniekafmlmkdkpkdlikpvvila
Timeline for d2nvbb1: