SCOPe 2.06: Domain d2nu5b_: 2nu5 B:

Lineage for d2nu5b_ (2nu5 B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.77: beta-Prism I [51091] (3 superfamilies)
   consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.77.3: Mannose-binding lectins [51101] (2 families)

5. Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins)

6. Protein automated matches [190387] (3 species)
   not a true protein

7. Species Griffithsia sp. [TaxId:373036] [187241] (1 PDB entry)

8. Domain d2nu5b_: 2nu5 B: [148395]
   automated match to d2gtya1
   complexed with nag, so4

Details for d2nu5b_

PDB Entry: 2nu5, 1.56 Å

PDB Description: crystal structure of a complex of griffithsin cocrystallized with n- acetylglucosamine

PDB Compounds: (B:) Griffithsin

SCOPe Domain Sequences for d2nu5b_:

Sequence; same for both SEQRES and ATOM records:

>d2nu5b_ b.77.3.1 (B:) automated matches {Griffithsia sp. [TaxId: 373036]}
slthrkfggsggspfsglssiavrsgsyldaiiidgvhhggsggnlsptftfgsgeyisn
mtirsgdyidnisfetnmgrrfgpyggsggsantlsnvkviqingsagdyldsldiyyeq
y

Timeline for d2nu5b_:

• d2nu5b_ first appeared in SCOP 1.75, called d2nu5b1
  
• d2nu5b_ appears in SCOPe 2.05
  
• d2nu5b_ appears in SCOPe 2.07
  
• d2nu5b_ appears in the current release, SCOPe 2.08