Lineage for d2nu5b1 (2nu5 B:1-121)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 809114Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 809132Superfamily b.77.3: Mannose-binding lectins [51101] (1 family) (S)
  5. 809133Family b.77.3.1: Mannose-binding lectins [51102] (6 proteins)
  6. 809168Protein Griffithsin [141569] (2 species)
    single-chain subunits form a segment-swapped dimer
  7. 809169Species Griffithsia sp. Q66D336 [TaxId:373036] [159279] (2 PDB entries)
  8. 809173Domain d2nu5b1: 2nu5 B:1-121 [148395]
    automatically matched to d2gtya1
    complexed with ace, nag, so4

Details for d2nu5b1

PDB Entry: 2nu5 (more details), 1.56 Å

PDB Description: crystal structure of a complex of griffithsin cocrystallized with n- acetylglucosamine
PDB Compounds: (B:) Griffithsin

SCOP Domain Sequences for d2nu5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nu5b1 b.77.3.1 (B:1-121) Griffithsin {Griffithsia sp. Q66D336 [TaxId: 373036]}
slthrkfggsggspfsglssiavrsgsyldaiiidgvhhggsggnlsptftfgsgeyisn
mtirsgdyidnisfetnmgrrfgpyggsggsantlsnvkviqingsagdyldsldiyyeq
y

SCOP Domain Coordinates for d2nu5b1:

Click to download the PDB-style file with coordinates for d2nu5b1.
(The format of our PDB-style files is described here.)

Timeline for d2nu5b1: