Lineage for d2nu5b_ (2nu5 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813105Fold b.77: beta-Prism I [51091] (4 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 2813155Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. 2813156Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins)
  6. 2813268Protein automated matches [190387] (4 species)
    not a true protein
  7. 2813287Species Griffithsia sp. [TaxId:373036] [187241] (1 PDB entry)
  8. 2813289Domain d2nu5b_: 2nu5 B: [148395]
    automated match to d2gtya1
    complexed with nag, so4

Details for d2nu5b_

PDB Entry: 2nu5 (more details), 1.56 Å

PDB Description: crystal structure of a complex of griffithsin cocrystallized with n- acetylglucosamine
PDB Compounds: (B:) Griffithsin

SCOPe Domain Sequences for d2nu5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nu5b_ b.77.3.1 (B:) automated matches {Griffithsia sp. [TaxId: 373036]}
slthrkfggsggspfsglssiavrsgsyldaiiidgvhhggsggnlsptftfgsgeyisn
mtirsgdyidnisfetnmgrrfgpyggsggsantlsnvkviqingsagdyldsldiyyeq
y

SCOPe Domain Coordinates for d2nu5b_:

Click to download the PDB-style file with coordinates for d2nu5b_.
(The format of our PDB-style files is described here.)

Timeline for d2nu5b_: