Lineage for d2nr5f_ (2nr5 F:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2318682Superfamily a.25.6: SO2669-like [158418] (1 family) (S)
    (homo)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals
  5. 2318683Family a.25.6.1: SO2669-like [158419] (2 proteins)
  6. 2318687Protein automated matches [190741] (1 species)
    not a true protein
  7. 2318688Species Shewanella oneidensis [TaxId:211586] [187922] (1 PDB entry)
  8. 2318693Domain d2nr5f_: 2nr5 F: [148354]
    Other proteins in same PDB: d2nr5a1, d2nr5e3
    automated match to d2nr5a1
    complexed with act, mpd

Details for d2nr5f_

PDB Entry: 2nr5 (more details), 1.9 Å

PDB Description: Crystal Structure of Protein of Unknown Function SO2669 from Shewanella oneidensis MR-1
PDB Compounds: (F:) Hypothetical protein SO2669

SCOPe Domain Sequences for d2nr5f_:

Sequence, based on SEQRES records: (download)

>d2nr5f_ a.25.6.1 (F:) automated matches {Shewanella oneidensis [TaxId: 211586]}
tkkeriaiqrsmaeealgklkairqlcgaedssdssdmqeveiwtnrikeledwlwgesp
ia

Sequence, based on observed residues (ATOM records): (download)

>d2nr5f_ a.25.6.1 (F:) automated matches {Shewanella oneidensis [TaxId: 211586]}
tkkeriaiqrsmaeealgklkairqlcgaeddmqeveiwtnrikeledwlwgespia

SCOPe Domain Coordinates for d2nr5f_:

Click to download the PDB-style file with coordinates for d2nr5f_.
(The format of our PDB-style files is described here.)

Timeline for d2nr5f_: