Lineage for d2nr5a1 (2nr5 A:1-64)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2318682Superfamily a.25.6: SO2669-like [158418] (1 family) (S)
    (homo)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals
  5. 2318683Family a.25.6.1: SO2669-like [158419] (2 proteins)
  6. 2318684Protein Hypothetical protein SO2669 [158420] (1 species)
  7. 2318685Species Shewanella oneidensis [TaxId:70863] [158421] (1 PDB entry)
    Uniprot Q8EDS4 1-64
  8. 2318686Domain d2nr5a1: 2nr5 A:1-64 [148349]
    Other proteins in same PDB: d2nr5b_, d2nr5c_, d2nr5d_, d2nr5e2, d2nr5e3, d2nr5f_, d2nr5g_, d2nr5h_
    complexed with act, mpd

Details for d2nr5a1

PDB Entry: 2nr5 (more details), 1.9 Å

PDB Description: Crystal Structure of Protein of Unknown Function SO2669 from Shewanella oneidensis MR-1
PDB Compounds: (A:) Hypothetical protein SO2669

SCOPe Domain Sequences for d2nr5a1:

Sequence, based on SEQRES records: (download)

>d2nr5a1 a.25.6.1 (A:1-64) Hypothetical protein SO2669 {Shewanella oneidensis [TaxId: 70863]}
mmtkkeriaiqrsmaeealgklkairqlcgaedssdssdmqeveiwtnrikeledwlwge
spia

Sequence, based on observed residues (ATOM records): (download)

>d2nr5a1 a.25.6.1 (A:1-64) Hypothetical protein SO2669 {Shewanella oneidensis [TaxId: 70863]}
mmtkkeriaiqrsmaeealgklkairqlcgaedsdmqeveiwtnrikeledwlwgespia

SCOPe Domain Coordinates for d2nr5a1:

Click to download the PDB-style file with coordinates for d2nr5a1.
(The format of our PDB-style files is described here.)

Timeline for d2nr5a1: