Lineage for d2nr5d_ (2nr5 D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2318682Superfamily a.25.6: SO2669-like [158418] (1 family) (S)
    (homo)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals
  5. 2318683Family a.25.6.1: SO2669-like [158419] (2 proteins)
  6. 2318687Protein automated matches [190741] (1 species)
    not a true protein
  7. 2318688Species Shewanella oneidensis [TaxId:211586] [187922] (1 PDB entry)
  8. 2318691Domain d2nr5d_: 2nr5 D: [148352]
    Other proteins in same PDB: d2nr5a1, d2nr5e3
    automated match to d2nr5a1
    complexed with act, mpd

Details for d2nr5d_

PDB Entry: 2nr5 (more details), 1.9 Å

PDB Description: Crystal Structure of Protein of Unknown Function SO2669 from Shewanella oneidensis MR-1
PDB Compounds: (D:) Hypothetical protein SO2669

SCOPe Domain Sequences for d2nr5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nr5d_ a.25.6.1 (D:) automated matches {Shewanella oneidensis [TaxId: 211586]}
mtkkeriaiqrsmaeealgklkairqlcgaedssdssdmqeveiwtnrikeledwlwges
pia

SCOPe Domain Coordinates for d2nr5d_:

Click to download the PDB-style file with coordinates for d2nr5d_.
(The format of our PDB-style files is described here.)

Timeline for d2nr5d_: