Lineage for d2nqca_ (2nqc A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765751Family b.1.18.10: Filamin repeat (rod domain) [81290] (5 proteins)
    Pfam PF00630
  6. 2765806Protein automated matches [190375] (1 species)
    not a true protein
  7. 2765807Species Human (Homo sapiens) [TaxId:9606] [187222] (3 PDB entries)
  8. 2765809Domain d2nqca_: 2nqc A: [148344]
    automated match to d2nqca1
    complexed with gol, imd, ni

Details for d2nqca_

PDB Entry: 2nqc (more details), 2.05 Å

PDB Description: crystal structure of ig-like domain 23 from human filamin c
PDB Compounds: (A:) Filamin-C

SCOPe Domain Sequences for d2nqca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nqca_ b.1.18.10 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agdpglvsaygpgleggttgvssefivntlnagsgalsvtidgpskvqldcrecpeghvv
tytpmapgnyliaikyggpqhivgspfkakvtgprls

SCOPe Domain Coordinates for d2nqca_:

Click to download the PDB-style file with coordinates for d2nqca_.
(The format of our PDB-style files is described here.)

Timeline for d2nqca_: