Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.10: Filamin repeat (rod domain) [81290] (5 proteins) Pfam PF00630 |
Protein automated matches [190375] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187222] (3 PDB entries) |
Domain d2nqca_: 2nqc A: [148344] automated match to d2nqca1 complexed with gol, imd, ni |
PDB Entry: 2nqc (more details), 2.05 Å
SCOPe Domain Sequences for d2nqca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nqca_ b.1.18.10 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} agdpglvsaygpgleggttgvssefivntlnagsgalsvtidgpskvqldcrecpeghvv tytpmapgnyliaikyggpqhivgspfkakvtgprls
Timeline for d2nqca_: