SCOP 1.75: Domain d2nqca1: 2nqc A:2482-2578

Lineage for d2nqca1 (2nqc A:2482-2578)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (23 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.10: Filamin repeat (rod domain) [81290] (4 proteins)
   Pfam PF00630

6. Protein Filamin C [117049] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117050] (7 PDB entries)
   Uniprot Q14315 2633-2725

8. Domain d2nqca1: 2nqc A:2482-2578 [148344]
   automatically matched to d2d7qa1
   complexed with gol, imd, ni

Details for d2nqca1

PDB Entry: 2nqc, 2.05 Å

PDB Description: crystal structure of ig-like domain 23 from human filamin c

PDB Compounds: (A:) Filamin-C

SCOP Domain Sequences for d2nqca1:

Sequence; same for both SEQRES and ATOM records:

>d2nqca1 b.1.18.10 (A:2482-2578) Filamin C {Human (Homo sapiens) [TaxId: 9606]}
agdpglvsaygpgleggttgvssefivntlnagsgalsvtidgpskvqldcrecpeghvv
tytpmapgnyliaikyggpqhivgspfkakvtgprls

Timeline for d2nqca1:

• d2nqca1 is new in SCOP 1.75
  
• d2nqca1 appears in SCOPe 2.01
  
• d2nqca1 appears in the current release, SCOPe 2.08, called d2nqca_