PDB entry 2nqc

View 2nqc on RCSB PDB site
Description: Crystal structure of ig-like domain 23 from human filamin C
Class: immune system
Keywords: filamin, immunoglobulin, metal binding, immune system
Deposited on 2006-10-31, released 2007-09-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Filamin-C
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2nqca_
  • Heterogens: NI, IMD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2nqcA (A:)
gshmasmtggqqmgrgsgshmasmtggqqmgrgsrvgeqsqagdpglvsaygpgleggtt
gvssefivntlnagsgalsvtidgpskvqldcrecpeghvvtytpmapgnyliaikyggp
qhivgspfkakvtgprls

    Sequence, based on observed residues (ATOM records): (download) 
    >2nqcA (A:)
agdpglvsaygpgleggttgvssefivntlnagsgalsvtidgpskvqldcrecpeghvv
tytpmapgnyliaikyggpqhivgspfkakvtgprls