Lineage for d2nn6h3 (2nn6 H:168-293)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1025556Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 1025557Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (1 family) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 1025558Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (16 proteins)
    an RNA-binding domain
  6. 1025628Protein Ribosomal RNA-processing protein 4, RRP4 [160227] (1 species)
  7. 1025629Species Human (Homo sapiens) [TaxId:9606] [160228] (1 PDB entry)
    Uniprot Q13868 168-293
  8. 1025630Domain d2nn6h3: 2nn6 H:168-293 [148312]
    Other proteins in same PDB: d2nn6a1, d2nn6a2, d2nn6b1, d2nn6b2, d2nn6c1, d2nn6c2, d2nn6d1, d2nn6d2, d2nn6e1, d2nn6e2, d2nn6f1, d2nn6f2, d2nn6g1, d2nn6g2, d2nn6g3, d2nn6h1, d2nn6h2, d2nn6i1, d2nn6i2
    protein/RNA complex

Details for d2nn6h3

PDB Entry: 2nn6 (more details), 3.35 Å

PDB Description: Structure of the human RNA exosome composed of Rrp41, Rrp45, Rrp46, Rrp43, Mtr3, Rrp42, Csl4, Rrp4, and Rrp40
PDB Compounds: (H:) Exosome complex exonuclease RRP4

SCOPe Domain Sequences for d2nn6h3:

Sequence, based on SEQRES records: (download)

>d2nn6h3 d.51.1.1 (H:168-293) Ribosomal RNA-processing protein 4, RRP4 {Human (Homo sapiens) [TaxId: 9606]}
qgvlvqvspslvkrqkthfhdlpcgasvilgnngfiwiyptpehkeeeaggfianlepvs
ladrevisrlrnciislvtqrmmlydtsilycyeaslphqikdilkpeimeeivmetrqr
lleqeg

Sequence, based on observed residues (ATOM records): (download)

>d2nn6h3 d.51.1.1 (H:168-293) Ribosomal RNA-processing protein 4, RRP4 {Human (Homo sapiens) [TaxId: 9606]}
qgvlvqvspslvkrqkthfhdlpcgasvilgnngfiwiyptpehgfianlepvsladrev
isrlrnciislvtqrmmlydtsilycyeaslphqikdilkpeimeeivmetrqrlleqeg

SCOPe Domain Coordinates for d2nn6h3:

Click to download the PDB-style file with coordinates for d2nn6h3.
(The format of our PDB-style files is described here.)

Timeline for d2nn6h3: