| Class b: All beta proteins [48724] (174 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) ![]() |
| Family b.34.9.2: PWWP domain [69250] (6 proteins) includes the C-terminal all-alpha subdomain |
| Protein Hepatoma-derived growth factor, HDGF [117151] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [117152] (2 PDB entries) Uniprot P51858 1-100 |
| Domain d2nlua1: 2nlu A:1-100 [148284] automatically matched to d2b8aa1 |
PDB Entry: 2nlu (more details)
SCOPe Domain Sequences for d2nlua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nlua1 b.34.9.2 (A:1-100) Hepatoma-derived growth factor, HDGF {Human (Homo sapiens) [TaxId: 9606]}
msrsnrqkeykcgdlvfakmkgyphwparidempeaavkstankyqvfffgthetaflgp
kdlfpyeeskekfgkpnkrkgfseglweiennptvkasgy
Timeline for d2nlua1: