SCOPe 2.08: Domain d2nlua_: 2nlu A:

Lineage for d2nlua_ (2nlu A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families)

5. Family b.34.9.2: PWWP domain [69250] (6 proteins)
   includes the C-terminal all-alpha subdomain

6. Protein automated matches [190966] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188600] (9 PDB entries)

8. Domain d2nlua_: 2nlu A: [148284]
   automated match to d2b8aa1

Details for d2nlua_

PDB Entry: 2nlu

PDB Description: domain-swapped dimer of the pwwp module of human hepatoma-derived growth factor

PDB Compounds: (A:) Hepatoma-derived growth factor

SCOPe Domain Sequences for d2nlua_:

Sequence; same for both SEQRES and ATOM records:

>d2nlua_ b.34.9.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msrsnrqkeykcgdlvfakmkgyphwparidempeaavkstankyqvfffgthetaflgp
kdlfpyeeskekfgkpnkrkgfseglweiennptvkasgy

Timeline for d2nlua_:

• d2nlua_ first appeared in SCOP 1.75, called d2nlua1
  
• d2nlua_ appears in SCOPe 2.07