PDB entry 2nlu

View 2nlu on RCSB PDB site
Description: Domain-Swapped Dimer of the PWWP Module of Human Hepatoma-derived Growth Factor
Class: hormone/growth factor
Keywords: HDGF, hHDGF, HRP, HATH, PWWP, Heparin, domain-swapping, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2006-10-20, released 2007-09-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatoma-derived growth factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2nlua1
  • Chain 'B':
    Compound: Hepatoma-derived growth factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2nlub1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2nluA (A:)
msrsnrqkeykcgdlvfakmkgyphwparidempeaavkstankyqvfffgthetaflgp
kdlfpyeeskekfgkpnkrkgfseglweiennptvkasgy

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2nluB (B:)
msrsnrqkeykcgdlvfakmkgyphwparidempeaavkstankyqvfffgthetaflgp
kdlfpyeeskekfgkpnkrkgfseglweiennptvkasgy