Lineage for d2nlub1 (2nlu B:101-200)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309919Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1311123Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 1311200Family b.34.9.2: PWWP domain [69250] (6 proteins)
    includes the C-terminal all-alpha subdomain
  6. 1311206Protein Hepatoma-derived growth factor, HDGF [117151] (2 species)
  7. 1311207Species Human (Homo sapiens) [TaxId:9606] [117152] (2 PDB entries)
    Uniprot P51858 1-100
  8. 1311209Domain d2nlub1: 2nlu B:101-200 [148285]
    automatically matched to d2b8aa1

Details for d2nlub1

PDB Entry: 2nlu (more details)

PDB Description: domain-swapped dimer of the pwwp module of human hepatoma-derived growth factor
PDB Compounds: (B:) Hepatoma-derived growth factor

SCOPe Domain Sequences for d2nlub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nlub1 b.34.9.2 (B:101-200) Hepatoma-derived growth factor, HDGF {Human (Homo sapiens) [TaxId: 9606]}
msrsnrqkeykcgdlvfakmkgyphwparidempeaavkstankyqvfffgthetaflgp
kdlfpyeeskekfgkpnkrkgfseglweiennptvkasgy

SCOPe Domain Coordinates for d2nlub1:

Click to download the PDB-style file with coordinates for d2nlub1.
(The format of our PDB-style files is described here.)

Timeline for d2nlub1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2nlua1