SCOPe 2.04: Domain d2k7wa_: 2k7w A:

Lineage for d2k7wa_ (2k7w A:)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein Proapoptotic molecule Bax [56862] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56863] (2 PDB entries)

8. Domain d2k7wa_: 2k7w A: [148280]
   automated match to d2k7wa1

Details for d2k7wa_

PDB Entry: 2k7w

PDB Description: bax activation is initiated at a novel interaction site

PDB Compounds: (A:) Apoptosis regulator BAX

SCOPe Domain Sequences for d2k7wa_:

Sequence; same for both SEQRES and ATOM records:

>d2k7wa_ f.1.4.1 (A:) Proapoptotic molecule Bax {Human (Homo sapiens) [TaxId: 9606]}
mdgsgeqprgggptsseqimktgalllqgfiqdragrmggeapelaldpvpqdastkkls
eclkrigdeldsnmelqrmiaavdtdsprevffrvaadmfsdgnfnwgrvvalfyfaskl
vlkalctkvpelirtimgwtldflrerllgwiqdqggwdgllsyfgtptwqtvtifvagv
ltasltiwkkmg

Timeline for d2k7wa_:

• d2k7wa_ first appeared in SCOP 1.75, called d2k7wa1
  
• d2k7wa_ was called d2k7wa1 in SCOPe 2.03
  
• d2k7wa_ appears in SCOPe 2.05
  
• d2k7wa_ appears in the current release, SCOPe 2.08