SCOP 1.75: Domain d2k7wa1: 2k7w A:1-192

Lineage for d2k7wa1 (2k7w A:1-192)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (1 family)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (10 proteins)
   Pfam PF00452

6. Protein Proapoptotic molecule Bax [56862] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56863] (2 PDB entries)

8. Domain d2k7wa1: 2k7w A:1-192 [148280]
   automatically matched to d1f16a_

Details for d2k7wa1

PDB Entry: 2k7w

PDB Description: bax activation is initiated at a novel interaction site

PDB Compounds: (A:) Apoptosis regulator BAX

SCOP Domain Sequences for d2k7wa1:

Sequence; same for both SEQRES and ATOM records:

>d2k7wa1 f.1.4.1 (A:1-192) Proapoptotic molecule Bax {Human (Homo sapiens) [TaxId: 9606]}
mdgsgeqprgggptsseqimktgalllqgfiqdragrmggeapelaldpvpqdastkkls
eclkrigdeldsnmelqrmiaavdtdsprevffrvaadmfsdgnfnwgrvvalfyfaskl
vlkalctkvpelirtimgwtldflrerllgwiqdqggwdgllsyfgtptwqtvtifvagv
ltasltiwkkmg

Timeline for d2k7wa1:

• d2k7wa1 is new in SCOP 1.75
  
• d2k7wa1 appears in SCOPe 2.01
  
• d2k7wa1 appears in the current release, SCOPe 2.08, called d2k7wa_