![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
![]() | Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) ![]() PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
![]() | Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins) Pfam PF00452 |
![]() | Protein Proapoptotic molecule Bax [56862] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [56863] (7 PDB entries) |
![]() | Domain d2k7wa_: 2k7w A: [148280] automated match to d2k7wa1 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2k7w (more details)
SCOPe Domain Sequences for d2k7wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k7wa_ f.1.4.1 (A:) Proapoptotic molecule Bax {Human (Homo sapiens) [TaxId: 9606]} mdgsgeqprgggptsseqimktgalllqgfiqdragrmggeapelaldpvpqdastkkls eclkrigdeldsnmelqrmiaavdtdsprevffrvaadmfsdgnfnwgrvvalfyfaskl vlkalctkvpelirtimgwtldflrerllgwiqdqggwdgllsyfgtptwqtvtifvagv ltasltiwkkmg
Timeline for d2k7wa_: