Lineage for d2k3ba1 (2k3b A:2-59)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 946133Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 946224Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 946225Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 946245Protein Actin binding protein ABP1 [74920] (1 species)
  7. 946246Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [74921] (2 PDB entries)
  8. 946248Domain d2k3ba1: 2k3b A:2-59 [148264]
    automatically matched to d1jo8a_

Details for d2k3ba1

PDB Entry: 2k3b (more details)

PDB Description: seeing the invisible: structures of excited protein states by relaxation dispersion nmr
PDB Compounds: (A:) Actin-binding protein

SCOPe Domain Sequences for d2k3ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k3ba1 b.34.2.1 (A:2-59) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pwataeydydaaedneltfvendkiiniefvdddwwlgelekdgskglfpsnyvslgn

SCOPe Domain Coordinates for d2k3ba1:

Click to download the PDB-style file with coordinates for d2k3ba1.
(The format of our PDB-style files is described here.)

Timeline for d2k3ba1: