PDB entry 2k3b

View 2k3b on RCSB PDB site
Description: Seeing the Invisible: Structures of Excited Protein States by Relaxation Dispersion NMR
Class: structural protein
Keywords: CPMG, Abp1p, Ark1p, Invisible State, NMR, Acetylation, Actin-binding, Cytoplasm, Cytoskeleton, Phosphoprotein, SH3 domain, STRUCTURAL PROTEIN
Deposited on 2008-04-30, released 2008-07-29
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Actin-binding protein
    Species: SACCHAROMYCES CEREVISIAE
    Gene: ABP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15891 (4-61)
      • expression tag (3)
    Domains in SCOPe 2.01: d2k3ba1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2k3bA (A:)
    gamapwataeydydaaedneltfvendkiiniefvdddwwlgelekdgskglfpsnyvsl
    gn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2k3bA (A:)
    apwataeydydaaedneltfvendkiiniefvdddwwlgelekdgskglfpsnyvslgn