SCOPe 2.08: Domain d2k3ba2: 2k3b A:2-59

Lineage for d2k3ba2 (2k3b A:2-59)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein Actin binding protein ABP1 [74920] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [74921] (2 PDB entries)

8. Domain d2k3ba2: 2k3b A:2-59 [148264]
   Other proteins in same PDB: d2k3ba3
   automated match to d1jo8a_

Details for d2k3ba2

PDB Entry: 2k3b

PDB Description: seeing the invisible: structures of excited protein states by relaxation dispersion nmr

PDB Compounds: (A:) Actin-binding protein

SCOPe Domain Sequences for d2k3ba2:

Sequence; same for both SEQRES and ATOM records:

>d2k3ba2 b.34.2.1 (A:2-59) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pwataeydydaaedneltfvendkiiniefvdddwwlgelekdgskglfpsnyvslgn

Timeline for d2k3ba2:

• d2k3ba2 first appeared in SCOP 1.75, called d2k3ba1
  
• d2k3ba2 appears in SCOPe 2.07