SCOPe 2.07: Domain d2jt6a_: 2jt6 A:

Lineage for d2jt6a_ (2jt6 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Stromelysin-1 (MMP-3) [55536] (1 species)

7. Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (42 PDB entries)

8. Domain d2jt6a_: 2jt6 A: [148200]
   automated match to d2jt6a1
   complexed with ca, jt6, zn

Details for d2jt6a_

PDB Entry: 2jt6

PDB Description: solution structure of matrix metalloproteinase 3 (mmp-3) in the presence of 3-4'-cyanobyphenyl-4-yloxy)-n-hdydroxypropionamide (mmp-3 inhibitor vii)

PDB Compounds: (A:) stromelysin-1

SCOPe Domain Sequences for d2jt6a_:

Sequence; same for both SEQRES and ATOM records:

>d2jt6a_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
gipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadimisfa
vrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaaheighsl
glfhsantealmyplyhsltdltrfrlsqddingiqslygp

Timeline for d2jt6a_:

• d2jt6a_ first appeared in SCOP 1.75, called d2jt6a1
  
• d2jt6a_ appears in SCOPe 2.06
  
• d2jt6a_ appears in the current release, SCOPe 2.08