![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
![]() | Protein Stromelysin-1 (MMP-3) [55536] (1 species) |
![]() | Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (42 PDB entries) |
![]() | Domain d2jt6a_: 2jt6 A: [148200] automated match to d2jt6a1 complexed with ca, jt6, zn |
PDB Entry: 2jt6 (more details)
SCOPe Domain Sequences for d2jt6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jt6a_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]} gipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadimisfa vrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaaheighsl glfhsantealmyplyhsltdltrfrlsqddingiqslygp
Timeline for d2jt6a_: