Lineage for d2jt6a_ (2jt6 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964231Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2964558Protein Stromelysin-1 (MMP-3) [55536] (1 species)
  7. 2964559Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (42 PDB entries)
  8. 2964620Domain d2jt6a_: 2jt6 A: [148200]
    automated match to d2jt6a1
    complexed with ca, jt6, zn

Details for d2jt6a_

PDB Entry: 2jt6 (more details)

PDB Description: solution structure of matrix metalloproteinase 3 (mmp-3) in the presence of 3-4'-cyanobyphenyl-4-yloxy)-n-hdydroxypropionamide (mmp-3 inhibitor vii)
PDB Compounds: (A:) stromelysin-1

SCOPe Domain Sequences for d2jt6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jt6a_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
gipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadimisfa
vrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaaheighsl
glfhsantealmyplyhsltdltrfrlsqddingiqslygp

SCOPe Domain Coordinates for d2jt6a_:

Click to download the PDB-style file with coordinates for d2jt6a_.
(The format of our PDB-style files is described here.)

Timeline for d2jt6a_: