SCOPe 2.04: Domain d2jiwa3: 2jiw A:4-126

Lineage for d2jiwa3 (2jiw A:4-126)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families)
   contains similar fold but lacks its catalytic centre

5. Family d.92.2.0: automated matches [227269] (1 protein)
   not a true family

6. Protein automated matches [227062] (4 species)
   not a true protein

7. Species Bacteroides thetaiotaomicron [TaxId:226186] [255267] (4 PDB entries)

8. Domain d2jiwa3: 2jiw A:4-126 [148103]
   Other proteins in same PDB: d2jiwa1, d2jiwa2, d2jiwb1, d2jiwb2
   automated match to d2vvna3
   complexed with beu

Details for d2jiwa3

PDB Entry: 2jiw, 1.95 Å

PDB Description: bacteroides thetaiotaomicron gh84 o-glcnacase in complex with 2-acetylamino-2-deoxy-1-epivalienamine

PDB Compounds: (A:) o-glcnacase bt_4395

SCOPe Domain Sequences for d2jiwa3:

Sequence; same for both SEQRES and ATOM records:

>d2jiwa3 d.92.2.0 (A:4-126) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
slqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisigekg
dksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikd
yps

Timeline for d2jiwa3:

• d2jiwa3 first appeared in SCOP 1.75
  
• d2jiwa3 appears in SCOPe 2.03
  
• d2jiwa3 appears in SCOPe 2.05
  
• d2jiwa3 appears in the current release, SCOPe 2.08