Lineage for d2jiwa3 (2jiw A:4-126)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2965096Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 2965198Family d.92.2.0: automated matches [227269] (1 protein)
    not a true family
  6. 2965199Protein automated matches [227062] (5 species)
    not a true protein
  7. 2965200Species Bacteroides thetaiotaomicron [TaxId:226186] [255267] (4 PDB entries)
  8. 2965201Domain d2jiwa3: 2jiw A:4-126 [148103]
    Other proteins in same PDB: d2jiwa1, d2jiwa2, d2jiwb1, d2jiwb2
    automated match to d2vvna3
    complexed with beu

Details for d2jiwa3

PDB Entry: 2jiw (more details), 1.95 Å

PDB Description: bacteroides thetaiotaomicron gh84 o-glcnacase in complex with 2-acetylamino-2-deoxy-1-epivalienamine
PDB Compounds: (A:) o-glcnacase bt_4395

SCOPe Domain Sequences for d2jiwa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jiwa3 d.92.2.0 (A:4-126) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
slqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisigekg
dksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikd
yps

SCOPe Domain Coordinates for d2jiwa3:

Click to download the PDB-style file with coordinates for d2jiwa3.
(The format of our PDB-style files is described here.)

Timeline for d2jiwa3: