| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) ![]() contains similar fold but lacks its catalytic centre |
| Family d.92.2.0: automated matches [227269] (1 protein) not a true family |
| Protein automated matches [227062] (4 species) not a true protein |
| Species Bacteroides thetaiotaomicron [TaxId:226186] [255267] (4 PDB entries) |
| Domain d2jiwa3: 2jiw A:4-126 [148103] Other proteins in same PDB: d2jiwa1, d2jiwa2, d2jiwb1, d2jiwb2 automated match to d2vvna3 complexed with beu |
PDB Entry: 2jiw (more details), 1.95 Å
SCOPe Domain Sequences for d2jiwa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jiwa3 d.92.2.0 (A:4-126) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
slqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisigekg
dksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikd
yps
Timeline for d2jiwa3: