SCOPe 2.08: Domain d2jg3a1: 2jg3 A:23-243

Lineage for d2jg3a1 (2jg3 A:23-243)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.27: DNA methylase TaqI, N-terminal domain [88787] (2 proteins)

6. Protein automated matches [254551] (1 species)
   not a true protein
7. Species Thermus aquaticus [TaxId:271] [255260] (1 PDB entry)

8. Domain d2jg3a1: 2jg3 A:23-243 [148035]
   Other proteins in same PDB: d2jg3a2, d2jg3d2
   automated match to d1g38a1
   protein/DNA complex; complexed with ba2, gol, k

Details for d2jg3a1

PDB Entry: 2jg3, 1.9 Å

PDB Description: mtaqi with baz

PDB Compounds: (A:) modification methylase taqi

SCOPe Domain Sequences for d2jg3a1:

Sequence; same for both SEQRES and ATOM records:

>d2jg3a1 c.66.1.27 (A:23-243) automated matches {Thermus aquaticus [TaxId: 271]}
tppevvdfmvslaeaprggrvlepacahgpflrafreahgtayrfvgveidpkaldlppw
aegiladfllwepgeafdlilgnppygivgeaskypihvfkavkdlykkafstwkgkynl
ygaflekavrllkpggvlvfvvpatwlvledfallreflaregktsvyylgevfpqkkvs
avvirfqksgkglslwdtqesesgftpilwaeyphwegeii

Timeline for d2jg3a1:

• d2jg3a1 first appeared in SCOP 1.75
  
• d2jg3a1 appears in SCOPe 2.07